PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g14020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 212aa    MW: 24260.6 Da    PI: 9.8838
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g14020genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.4e-1880134256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq + Le+ F+ + ++   +++eLA+kl+L+ rqV vWFqNrRa+ k
  CA07g14020  80 RKKLRLTKEQSTLLEDSFKLHTTLAMGQKQELAAKLKLKPRQVEVWFQNRRARTK 134
                 678899***********************************************98 PP

2HD-ZIP_I/II114.46.7e-3780168189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+keq++lLE+sF+ +++L   +K+ela +L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+ en+rL+ke +eLr+
   CA07g14020  80 RKKLRLTKEQSTLLEDSFKLHTTLAMGQKQELAAKLKLKPRQVEVWFQNRRARTKLKQTEVDCEFLKKWCQSLNGENNRLKKELQELRS 168
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-1757137IPR009057Homeodomain-like
SuperFamilySSF466899.84E-1870137IPR009057Homeodomain-like
PROSITE profilePS5007116.3976136IPR001356Homeobox domain
SMARTSM003894.0E-1578140IPR001356Homeobox domain
PfamPF000461.0E-1580134IPR001356Homeobox domain
CDDcd000861.11E-1280137No hitNo description
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
SMARTSM003404.5E-17136179IPR003106Leucine zipper, homeobox-associated
PfamPF021831.1E-9136168IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MGNDDNEACD TRLTLGLATS DHHILPKQNQ DDHKKITCQD LSIIPLHSSH DGTDKIDGSS  60
SKTCKNYTKF NNESKKIGMR KKLRLTKEQS TLLEDSFKLH TTLAMGQKQE LAAKLKLKPR  120
QVEVWFQNRR ARTKLKQTEV DCEFLKKWCQ SLNGENNRLK KELQELRSIK IDQRIHLQLS  180
KARTLALCSS CRKISRGDTD EKHETGTESG W*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555480.11e-153PREDICTED: homeobox-leucine zipper protein HAT22-like
SwissprotP466042e-47HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLK4CFY31e-117K4CFY3_SOLLC; Uncharacterized protein
STRINGSolyc07g054380.1.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.17e-45HD-ZIP family protein